PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_3AS_475B27CF6.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB_related
Protein Properties Length: 213aa    MW: 22385.8 Da    PI: 4.8821
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_3AS_475B27CF6.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-131253346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           + ++ E+e ++ + k lG++ W+ Ia +m+ gRt++++k++w++
  Traes_3AS_475B27CF6.1 12 PISKREEETIISLQKSLGNR-WSVIAGKMP-GRTDNEIKNYWNS 53
                           56889***************.*********.***********95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-21158IPR009057Homeodomain-like
SuperFamilySSF466891.94E-13160IPR009057Homeodomain-like
PROSITE profilePS5129420.784559IPR017930Myb domain
SMARTSM007172.2E-12957IPR001005SANT/Myb domain
CDDcd001672.43E-101252No hitNo description
PfamPF002493.1E-111253IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 213 aa     Download sequence    Send to blast
MNYLRPDLKK EPISKREEET IISLQKSLGN RWSVIAGKMP GRTDNEIKNY WNSRIRKRQT  60
LSTGGGKGDS GLAKQGDLPA ADDKASVLAG PRGKEPVSSM ASGATVPPVP ARFPMFACQL  120
LGGGGGAAAI AAAGTTESTT THQNNGAGSE SDAASVGNGS AAGDDGREGH YYYCAVDGDI  180
DMVHLMSFDD LLEYPAGDLL MDAWDQNGLY STN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1225851107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232989.12e-59PREDICTED: myb-related protein Myb4
TrEMBLW5CJZ11e-157W5CJZ1_WHEAT; Uncharacterized protein
STRINGMLOC_19052.11e-117(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38620.13e-23myb domain protein 4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]